PDB entry 2gv0

View 2gv0 on RCSB PDB site
Description: The structure of the orthorhombic form of soft-shelled turtle lysozyme at 1.9 angstroms resolution
Class: Hydrolase
Keywords: lysozyme, hydrolase
Deposited on 2006-05-02, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Pelodiscus sinensis [TaxId:13735]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gv0a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gv0A (A:)
    gkiyeqcelarefkrhgmdgyhgyslgdwvctakhesnfntaatnynrgdqstdygilqi
    nsrwwcndgktpkaknacgiecsellkaditaavncakrivrdpngmgawvawtkyckgk
    dvsqwikgckl