PDB entry 2guk

View 2guk on RCSB PDB site
Description: Crystal Structure of the Conserved Protein of Unknown Function from Porphyromonas gingivalis
Class: structural genomics, unknown function
Keywords: alpha-beta, alpha-helical bundle, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-05-01, released 2006-05-30
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.237
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PG1857
    Species: Porphyromonas gingivalis
    Gene: PG1587, GeneID:2551814
    Database cross-references and differences (RAF-indexed):
    • GB NP_905947
      • modified residue (16)
      • modified residue (29)
      • modified residue (74)
      • modified residue (100)
    Domains in SCOP 1.75: d2guka1
  • Chain 'B':
    Compound: hypothetical protein PG1857
    Species: Porphyromonas gingivalis
    Gene: PG1587, GeneID:2551814
    Database cross-references and differences (RAF-indexed):
    • GB NP_905947 (Start-119)
      • modified residue (16)
      • modified residue (29)
      • modified residue (74)
      • modified residue (100)
    Domains in SCOP 1.75: d2gukb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gukA (A:)
    snamdtqtlnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptp
    ntertnlffgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrksns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gukA (A:)
    qtlnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertn
    lffgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gukB (B:)
    snamdtqtlnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptp
    ntertnlffgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrksns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gukB (B:)
    lnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertnlf
    fgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrksns