PDB entry 2gui

View 2gui on RCSB PDB site
Description: Structure and Function of Cyclized Versions of the Proofreading Exonuclease Subunit of E. coli DNA Polymerase III
Class: transferase
Keywords: DNA polymerase proofreading domain, TRANSFERASE
Deposited on 2006-04-30, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III epsilon subunit
    Species: Escherichia coli [TaxId:562]
    Gene: dnaQ, mutD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2guia_
  • Heterogens: MN, U5P, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2guiA (A:)
    siefstaitrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrl
    vdpeafgvhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrd
    ipktntfckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevyla
    mtggqtsmatresg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2guiA (A:)
    itrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafg
    vhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntf
    ckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg