PDB entry 2gu8

View 2gu8 on RCSB PDB site
Description: Discovery of 2-Pyrimidyl-5-Amidothiophenes as Novel and Potent Inhibitors for AKT: Synthesis and SAR Studies
Class: signaling protein,transferase/inhibitor
Keywords: CAMP-dependent protein kinase, PKA, Akt, Kinase, Drug Design, ternary complex, SIGNALING PROTEIN,TRANSFERASE/INHIBITOR COMPLEX
Deposited on 2006-04-28, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gu8a_
  • Chain 'C':
    Compound: inhibitor of CAMP-dependent protein kinase
    Database cross-references and differences (RAF-indexed):
    • PDB 2GU8 (0-19)
  • Heterogens: 796, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gu8A (A:)
svkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenllideqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

  • Chain 'C':
    No sequence available.