PDB entry 2gu5

View 2gu5 on RCSB PDB site
Description: E. coli methionine aminopeptidase in complex with NleP, 1: 1, di-metalated
Class: hydrolase
Keywords: Mono-metalated, mononuclear, Mn(II)-form, hydrolase, enzyme-inhibitor complex, metalloenzyme
Deposited on 2006-04-28, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gu5a_
  • Chain 'B':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gu5b_
  • Heterogens: MN, NA, NLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gu5A (A:)
    assiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gu5A (A:)
    siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
    gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
    rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
    lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
    gceiltlrkddtipaiishde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gu5B (B:)
    assiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gu5B (B:)
    siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
    gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
    rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
    lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
    gceiltlrkddtipaiishde