PDB entry 2gty

View 2gty on RCSB PDB site
Description: Crystal structure of unliganded griffithsin
Class: sugar binding protein
Keywords: griffithsin, lectins, domain swapping, mannose binding, HIV, SARS, SUGAR BINDING PROTEIN
Deposited on 2006-04-28, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.159
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Griffithsin
    Species: Griffithsia [TaxId:35158]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtya1
  • Chain 'B':
    Compound: Griffithsin
    Species: Griffithsia [TaxId:35158]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtyb1
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gtyA (A:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gtyB (B:)
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y