PDB entry 2gtx

View 2gtx on RCSB PDB site
Description: Structural Basis of Catalysis by Mononuclear Methionine Aminopeptidase
Class: hydrolase
Keywords: Mononuclear, Mn(II)-form, hydrolase, enzyme-inhibitor complex, metalloenzyme
Deposited on 2006-04-28, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gtxa_
  • Chain 'B':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gtxb_
  • Heterogens: MN, NA, NLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gtxA (A:)
    siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
    gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
    rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
    lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
    gceiltlrkddtipaiishde
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gtxB (B:)
    siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
    gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
    rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
    lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
    gceiltlrkddtipaiishde