PDB entry 2gtv

View 2gtv on RCSB PDB site
Description: NMR structure of monomeric chorismate mutase from Methanococcus jannaschii
Class: isomerase
Keywords: four-helix bundle
Deposited on 2006-04-28, released 2006-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: chorismate mutase
  Species: Methanococcus jannaschii
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57696 (0-100)
    • insertion (20-27)
    • conflict (84)
    • his tag (101-103)
  Domains in SCOP 1.73: d2gtvx1
• Heterogens: TSA

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gtvX (X:)
  mieklaeirkkideidnkilkarwpwaekliaernslakdvaeiknqlgipindpereky
  iydrirklckehnvdenigikifqrliehnkalqkqyleetleh