PDB entry 2gtv

View 2gtv on RCSB PDB site
Description: NMR structure of monomeric chorismate mutase from Methanococcus jannaschii
Class: isomerase
Keywords: four-helix bundle, ISOMERASE
Deposited on 2006-04-28, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-07-22, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: chorismate mutase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57696 (0-100)
      • insertion (20-27)
      • conflict (84)
      • expression tag (101-103)
    Domains in SCOPe 2.08: d2gtvx1, d2gtvx2
  • Heterogens: TSA

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gtvX (X:)
mieklaeirkkideidnkilkarwpwaekliaernslakdvaeiknqlgipindpereky
iydrirklckehnvdenigikifqrliehnkalqkqyleetleh