PDB entry 2gtu

View 2gtu on RCSB PDB site
Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form
Deposited on 1998-05-26, released 1999-03-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-02, with a file datestamp of 1999-03-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.203
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gtuA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gtuB (B:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk