PDB entry 2gtu

View 2gtu on RCSB PDB site
Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, dimer
Deposited on 1998-05-26, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtua1, d2gtua2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtub1, d2gtub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gtuA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gtuB (B:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk