PDB entry 2gts

View 2gts on RCSB PDB site
Description: Structure of Protein of Unknown Function HP0062 from Helicobacter pylori
Class: structural genomics, unknown function
Keywords: MCSG, structural genomics, hypothetical protein, Helicobacter pylori, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2006-04-28, released 2006-05-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein HP0062
    Species: Helicobacter pylori [TaxId:210]
    Gene: GeneID:899000, HP0062
    Database cross-references and differences (RAF-indexed):
    • GB NP_206862
    Domains in SCOPe 2.05: d2gtsa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtsA (A:)
    msrvqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkst
    fnefdeaaqeqiawlkerirvleedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtsA (A:)
    vqmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfne
    fdeaaqeqiawlkerir