PDB entry 2gtr

View 2gtr on RCSB PDB site
Description: Human chromodomain Y-like protein
Class: structural genomics, unknown function
Keywords: chromodomain Y-like protein, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2006-04-28, released 2006-05-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain Y-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CDYL, CDYL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gtra_
  • Chain 'B':
    Compound: Chromodomain Y-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CDYL, CDYL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gtrb_
  • Chain 'C':
    Compound: Chromodomain Y-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CDYL, CDYL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gtrc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtrA (A:)
    ayryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgs
    vfccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasil
    plcdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgk
    glvsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkki
    wgsaqgmdsmlkylqrkidef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtrA (A:)
    ryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgsvf
    ccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasilpl
    cdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgkgl
    vsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkkiwg
    saqgmdsmlkylqrkide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gtrB (B:)
    ayryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgs
    vfccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasil
    plcdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgk
    glvsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkki
    wgsaqgmdsmlkylqrkidef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtrB (B:)
    yrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgsvfc
    cgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasilplc
    dvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgkglv
    sqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkkiwgs
    aqgmdsmlkylqrkidef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gtrC (C:)
    ayryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgs
    vfccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasil
    plcdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgk
    glvsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkki
    wgsaqgmdsmlkylqrkidef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtrC (C:)
    ryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgsvf
    ccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasilpl
    cdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgkgl
    vsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkkiwg
    saqgmdsmlk