PDB entry 2gtq

View 2gtq on RCSB PDB site
Description: Crystal structure of aminopeptidase N from human pathogen Neisseria meningitidis
Class: hydrolase
Keywords: alanine aminopeptidase, aminopeptidase N, M1 family peptidases, MCSG, PSI-2, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, HYDROLASE
Deposited on 2006-04-28, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.166
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis [TaxId:122586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JYV4 (Start-866)
      • modified residue (102)
      • modified residue (133)
      • modified residue (199)
      • modified residue (229)
      • modified residue (246)
      • modified residue (255)
      • modified residue (258)
      • modified residue (367)
      • modified residue (373)
      • modified residue (385)
      • modified residue (399)
      • modified residue (420)
      • modified residue (468)
      • modified residue (474-475)
      • modified residue (703)
      • modified residue (707)
      • modified residue (743)
    Domains in SCOPe 2.07: d2gtqa1, d2gtqa2, d2gtqa3, d2gtqa4
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtqA (A:)
    msktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsv
    kingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepeg
    frkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskps
    ylfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgle
    ydldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwt
    gnrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpv
    rpasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraa
    madanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvk
    vgllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnyp
    ysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisd
    dlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaak
    qenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavng
    nesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnka
    rsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknl
    vkqalqriraqeglskdvgeivgkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtqA (A:)
    tvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvkin
    gaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfrk
    itfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsylf
    alvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydl
    difmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnr
    vtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpa
    syeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamad
    anginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgl
    lnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypysd
    ddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisddll
    dnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakqen
    qsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngnes
    dtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkarsl
    igsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlvkq
    alqriraqeglskdvgeivgkild