PDB entry 2gtp

View 2gtp on RCSB PDB site
Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1
Class: signaling protein
Keywords: G protein signalling, RGS, heterotrimeric G protein, signalling complex, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-04-28, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtpa1, d2gtpa2
  • Chain 'B':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtpb1, d2gtpb2
  • Chain 'C':
    Compound: Regulator of G-protein signaling 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtpc_
  • Chain 'D':
    Compound: Regulator of G-protein signaling 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtpd_
  • Heterogens: ALF, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtpA (A:)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
    vqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtpA (A:)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdsaraddarqlfvlamtaelagvikrlwkdsgvqacfnrsreyqlndsaayylnd
    ldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfegv
    taiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdlfeeki
    kksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfda
    vtdviiknnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gtpB (B:)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
    vqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtpB (B:)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
    vqfvfdavtdviiknnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gtpC (C:)
    smsgmksskskdvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlaced
    ykktesdllpckaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviyt
    lmekdsyprflksdiylnllndlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtpC (C:)
    vlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllpck
    aeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprflk
    sdiylnllndlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gtpD (D:)
    smsgmksskskdvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlaced
    ykktesdllpckaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviyt
    lmekdsyprflksdiylnllndlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtpD (D:)
    vlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllpck
    aeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprflk
    sdiylnllndlq