PDB entry 2gtk

View 2gtk on RCSB PDB site
Description: Structure-based Design of Indole Propionic Acids as Novel PPARag CO-Agonists
Class: transcription regulator
Keywords: nuclear receptor, transcription regulator
Deposited on 2006-04-28, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtka_
  • Chain 'B':
    Compound: Decamer from Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 208, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtkA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtkA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkkevai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
    etdmslhpllqeiykdly
    

  • Chain 'B':
    No sequence available.