PDB entry 2gte

View 2gte on RCSB PDB site
Description: Drosophila OBP LUSH bound to attractant pheromone 11-cis-vaccenyl acetate
Class: transport protein
Keywords: pheromone binding protein, odorant binding protein, pheromone, TRANSPORT PROTEIN
Deposited on 2006-04-27, released 2007-06-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.178
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General odorant-binding protein lush
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: lush
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (0-123)
  Domains in SCOPe 2.02: d2gtea_
• Chain 'B':
  Compound: General odorant-binding protein lush
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: lush
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02372 (0-123)
  Domains in SCOPe 2.02: d2gteb_
• Heterogens: PO4, VA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gteA (A:)
  mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
  kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
  fmwp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gteB (B:)
  mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
  kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
  fmwp