PDB entry 2gte

View 2gte on RCSB PDB site
Description: Drosophila OBP LUSH bound to attractant pheromone 11-cis-vaccenyl acetate
Class: transport protein
Keywords: pheromone binding protein, odorant binding protein, pheromone
Deposited on 2006-04-27, released 2007-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.178
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General odorant-binding protein lush
    Species: Drosophila melanogaster
    Gene: lush
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gtea1
  • Chain 'B':
    Compound: General odorant-binding protein lush
    Species: Drosophila melanogaster
    Gene: lush
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gteb1
  • Heterogens: PO4, VA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gteA (A:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gteB (B:)
    mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
    kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
    fmwp