PDB entry 2gta

View 2gta on RCSB PDB site
Description: Crystal Structure of the putative pyrophosphatase YPJD from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR428.
Class: structural genomics, unknown function
Keywords: Pyrophosphatase, YPJD, NESG, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2006-04-27, released 2006-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ypjD
    Species: Bacillus subtilis
    Gene: ypjD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42979 (0-End)
      • modified residue (0)
      • modified residue (5)
      • modified residue (29-30)
      • modified residue (62)
      • modified residue (92)
    Domains in SCOP 1.73: d2gtaa1
  • Chain 'B':
    Compound: Hypothetical protein ypjD
    Species: Bacillus subtilis
    Gene: ypjD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42979 (0-End)
      • modified residue (0)
      • modified residue (5)
      • modified residue (29-30)
      • modified residue (62)
      • modified residue (92)
    Domains in SCOP 1.73: d2gtab1
  • Chain 'C':
    Compound: Hypothetical protein ypjD
    Species: Bacillus subtilis
    Gene: ypjD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42979
      • modified residue (5)
      • modified residue (29-30)
      • modified residue (62)
      • modified residue (92)
    Domains in SCOP 1.73: d2gtac1
  • Chain 'D':
    Compound: Hypothetical protein ypjD
    Species: Bacillus subtilis
    Gene: ypjD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42979 (Start-110)
      • modified residue (5)
      • modified residue (29-30)
      • modified residue (62)
      • modified residue (92)
      • his tag (111-113)
    Domains in SCOP 1.73: d2gtad1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gtaA (A:)
    msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkatedd
    ksmeeeigdvlfvlvclansldisleeahdrvmhkfntrdkdrwtrkeegklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtaA (A:)
    msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkatedd
    ksmeeeigdvlfvlvclansldisleeahdrvmhkfnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gtaB (B:)
    msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkatedd
    ksmeeeigdvlfvlvclansldisleeahdrvmhkfntrdkdrwtrkeegklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtaB (B:)
    msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkaksme
    eeigdvlfvlvclansldisleeahdrvmhkfntrd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gtaC (C:)
    msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkatedd
    ksmeeeigdvlfvlvclansldisleeahdrvmhkfntrdkdrwtrkeegklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtaC (C:)
    sdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrysmeeeigdvlfv
    lvclansldisleeahdrvmhkfntr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gtaD (D:)
    msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkatedd
    ksmeeeigdvlfvlvclansldisleeahdrvmhkfntrdkdrwtrkeegklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gtaD (D:)
    sdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygeksmeeeigdv
    lfvlvclansldisleeahdrvmhkfntrkeegkleh