PDB entry 2gt5

View 2gt5 on RCSB PDB site
Description: Solution structure of apo Human Sco1
Class: metal transport
Keywords: Thioredoxin-like fold, metalloprotein, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL TRANSPORT
Deposited on 2006-04-27, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SCO1 protein homolog, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: SCO1, SCOD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75880 (3-172)
    • cloning artifact (0-2)
  Domains in SCOPe 2.07: d2gt5a1, d2gt5a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gt5A (A:)
  sftgkpllggpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeid
  sittlpdltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspg
  pkdededyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks