PDB entry 2gt4

View 2gt4 on RCSB PDB site
Description: Crystal Structure of the Y103F mutant of the GDP-mannose mannosyl hydrolase in complex with GDP-mannose and MG+2
Class: hydrolase
Keywords: GDP-mannose hydrolase GDP-glucose hydrolase NUDIX GDP GDP-fucose, HYDROLASE
Deposited on 2006-04-27, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:83333]
    Gene: yefc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32056 (1-159)
      • initiating methionine (0)
      • engineered (102)
    Domains in SCOPe 2.08: d2gt4a_
  • Chain 'B':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:83333]
    Gene: yefc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32056 (1-159)
      • initiating methionine (0)
      • engineered (102)
    Domains in SCOPe 2.08: d2gt4b_
  • Chain 'C':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:83333]
    Gene: yefc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32056 (1-159)
      • initiating methionine (0)
      • engineered (102)
    Domains in SCOPe 2.08: d2gt4c_
  • Heterogens: MG, GDD, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gt4A (A:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthfvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gt4B (B:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthfvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gt4C (C:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthfvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl