PDB entry 2gt2

View 2gt2 on RCSB PDB site
Description: Structure of the E. coli GDP-mannose mannosyl hydrolase
Class: hydrolase
Keywords: GDP-mannose hydrolase GDP-glucose hydrolase NUDIX, HYDROLASE
Deposited on 2006-04-27, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: nudD, gmm, wcaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gt2a_
  • Chain 'B':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: nudD, gmm, wcaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gt2b_
  • Chain 'C':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: nudD, gmm, wcaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gt2c_
  • Chain 'D':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: nudD, gmm, wcaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gt2d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gt2A (A:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gt2A (A:)
    flrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaa
    ferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelldyrw
    ltsdallasdnvhansrayflaekrtgvpgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gt2B (B:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gt2B (B:)
    rqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaafe
    rltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeellldyrwl
    tsdallasdnvhansrayflaekrtgvpgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gt2C (C:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gt2C (C:)
    mflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetlea
    aferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllpd
    dyrwltsdallasdnvhansrayflaekrtgvpgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gt2D (D:)
    mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
    aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
    deqhddyrwltsdallasdnvhansrayflaekrtgvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gt2D (D:)
    lrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetleaaf
    erltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllddyr
    wltsdallasdnvhansrayflaekrtgvpgl