PDB entry 2gsy

View 2gsy on RCSB PDB site
Description: The 2.6A structure of Infectious Bursal Virus Derived T=1 Particles
Class: virus/viral protein
Keywords: virus-like capsid (protein-protein complex)
Deposited on 2006-04-27, released 2006-07-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.255
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsya1
  • Chain 'B':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyb1
  • Chain 'C':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyc1
  • Chain 'D':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyd1
  • Chain 'E':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsye1
  • Chain 'F':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyf1
  • Chain 'G':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyg1
  • Chain 'H':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyh1
  • Chain 'I':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyi1
  • Chain 'J':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyj1
  • Chain 'K':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyk1
  • Chain 'L':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyl1
  • Chain 'M':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsym1
  • Chain 'N':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyn1
  • Chain 'O':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyo1
  • Chain 'P':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyp1
  • Chain 'Q':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyq1
  • Chain 'R':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyr1
  • Chain 'S':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsys1
  • Chain 'T':
    Compound: Polyprotein
    Species: Avian infectious bursal disease virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gsyt1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gsyA (A:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyA (A:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gsyB (B:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyB (B:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gsyC (C:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyC (C:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gsyD (D:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyD (D:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gsyE (E:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyE (E:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
    tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
    gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
    frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
    ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
    vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
    evadlnsplkiag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gsyF (F:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyF (F:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
    tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
    gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
    frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
    ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
    vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
    evadlnsplkiag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2gsyG (G:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyG (G:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
    tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
    gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
    frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
    ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
    vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
    evadlnsplkiag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gsyH (H:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyH (H:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2gsyI (I:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyI (I:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2gsyJ (J:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyJ (J:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2gsyK (K:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyK (K:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2gsyL (L:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyL (L:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2gsyM (M:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyM (M:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2gsyN (N:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyN (N:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2gsyO (O:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyO (O:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2gsyP (P:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyP (P:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpgalngtinavtfq
    gslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigld
    pkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrt
    svhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikl
    eivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsn
    felipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmeva
    dlnsplkiag
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2gsyQ (Q:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyQ (Q:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpglngtinavtfqg
    slseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldp
    kmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrts
    vhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikle
    ivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnf
    elipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevad
    lnsplkiag
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2gsyR (R:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyR (R:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav
    tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai
    gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv
    frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits
    ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag
    vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm
    evadlnsplkiag
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2gsyS (S:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyS (S:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2gsyT (T:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiagafgfkdiirairriav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsyT (T:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl
    nsplkiag