PDB entry 2gsw

View 2gsw on RCSB PDB site
Description: Crystal Structure of the Putative NADPH-dependent Azobenzene FMN-Reductase YhdA from Bacillus subtilis, Northeast Structural Genomics Target SR135
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2006-04-26, released 2006-05-09
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.26
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yhdA
    Species: Bacillus subtilis subsp. subtilis str. 168
    Gene: yhdA
    Database cross-references and differences (RAF-indexed):
    • GB CAB12762
      • modified residue (2)
      • modified residue (77)
      • modified residue (117)
      • modified residue (121)
      • modified residue (164)
    Domains in SCOP 1.73: d2gswa1
  • Chain 'B':
    Compound: yhdA
    Species: Bacillus subtilis subsp. subtilis str. 168
    Gene: yhdA
    Database cross-references and differences (RAF-indexed):
    • GB CAB12762
      • modified residue (2)
      • modified residue (77)
      • modified residue (117)
      • modified residue (121)
      • modified residue (164)
    Domains in SCOP 1.73: d2gswb1
  • Chain 'C':
    Compound: yhdA
    Species: Bacillus subtilis subsp. subtilis str. 168
    Gene: yhdA
    Database cross-references and differences (RAF-indexed):
    • GB CAB12762
      • modified residue (2)
      • modified residue (77)
      • modified residue (117)
      • modified residue (121)
      • modified residue (164)
    Domains in SCOP 1.73: d2gswc1
  • Chain 'D':
    Compound: yhdA
    Species: Bacillus subtilis subsp. subtilis str. 168
    Gene: yhdA
    Database cross-references and differences (RAF-indexed):
    • GB CAB12762
      • modified residue (2)
      • modified residue (77)
      • modified residue (117)
      • modified residue (121)
      • modified residue (164)
    Domains in SCOP 1.73: d2gswd1
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gswA (A:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagnpgvlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gswA (A:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gswB (B:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagnpgvlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gswB (B:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gswC (C:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagnpgvlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gswC (C:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gswD (D:)
    mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
    vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
    vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagnpgvlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gswD (D:)
    mlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrvt
    kadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtvm
    rgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakag