PDB entry 2gsq

View 2gsq on RCSB PDB site
Description: glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione
Class: transferase
Keywords: squid digestive gland, sigma class, transferase
Deposited on 1995-04-14, released 1996-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.173
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Ommastrephes sloani [TaxId:6633]
    Gene: CDNA INSERT OF CLONE PGST5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gsqa1, d2gsqa2
  • Heterogens: SO4, GBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsqA (A:)
    pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
    sqsmciarhlarefgldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnye
    ksckrlapflegllvsngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkival
    rkrvaecpkiaaylkkrpvrdf