PDB entry 2gsj

View 2gsj on RCSB PDB site
Description: cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity
Class: hydrolase
Keywords: Parkia platycephala, Mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, x-ray crystal structure
Deposited on 2006-04-26, released 2007-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein PPL-2
  Species: Parkia platycephala [TaxId:185447]
  Database cross-references and differences (RAF-indexed):
  • PDB 2GSJ (0-270)
  Domains in SCOPe 2.05: d2gsja_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gsjA (A:)
  ggivvywgqnggegtltstcesglyqivniaflsqfgggrrpqinlaghcdpanngcrtv
  sdgiracqrrgikvmlsigggagsyslssvqdarsvadyiwnnflggrsssrplgdavld
  gvdfdiehggayydalarrlsehnrggkkvflsaapqcpfpdqslnkalstglfdyvwvq
  fynnpqcefnsgnpsnfrnswnkwtssfnakfyvglpaspeaagsgyvppqqlinqvlpf
  vkrspkyggvmlwdrfndlktkysskikpsv