PDB entry 2gsi

View 2gsi on RCSB PDB site
Description: Crystal Structure of a Murine Fab in Complex with an 11 Residue Peptide Derived from Staphylococcal Nuclease
Class: immune system
Keywords: fab, peptide, igg, staphylococcal nuclease
Deposited on 2006-04-26, released 2006-05-16
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin (kappa) light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsia1, d2gsia2
  • Chain 'B':
    Compound: Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsib1, d2gsib2
  • Chain 'C':
    Compound: Immunoglobulin (kappa) light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsic1, d2gsic2
  • Chain 'D':
    Compound: Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsid1, d2gsid2
  • Chain 'E':
    Compound: Immunoglobulin (kappa) light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsie1, d2gsie2
  • Chain 'F':
    Compound: Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsif1, d2gsif2
  • Chain 'G':
    Compound: Immunoglobulin (kappa) light chain
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsig1, d2gsig2
  • Chain 'H':
    Compound: Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)
    Species: Mus musculus
    Domains in SCOP 1.75: d2gsih1, d2gsih2
  • Chain 'W':
    Compound: Thermonuclease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Thermonuclease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Thermonuclease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Thermonuclease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsiA (A:)
    divltqspaslavslgqpatiscgasksvrtsgysymdwnqqkpgqpprrliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycshirelprssgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gsiB (B:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
    sakttppsvyplapgtaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsiB (B:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmamdywgqgttvttssakt
    tppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
    psstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsiC (C:)
    divltqspaslavslgqpatiscgasksvrtsgysymdwnqqkpgqpprrliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycshirelprssgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gsiD (D:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
    sakttppsvyplapgtaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsiD (D:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmqamdywgqgttvttssak
    ttppsvyplapgtaasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsiE (E:)
    divltqspaslavslgqpatiscgasksvrtsgysymdwnqqkpgqpprrliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycshirelprssgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gsiF (F:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
    sakttppsvyplapgtaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsiF (F:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmamdywgqgttvttssakt
    tppsvyplapgtaasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsiG (G:)
    divltqspaslavslgqpatiscgasksvrtsgysymdwnqqkpgqpprrliylvsnles
    gvparfsgsgsgtdftlnihpveeedaatyycshirelprssgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gsiH (H:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
    sakttppsvyplapgtaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsiH (H:)
    vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
    ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
    sakttppsvyplapmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.