PDB entry 2gs7

View 2gs7 on RCSB PDB site
Description: Crystal Structure of the inactive EGFR kinase domain in complex with AMP-PNP
Class: transferase
Keywords: EGFR, kinase, inactive, AMP-PNP, TRANSFERASE
Deposited on 2006-04-25, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (255)
    Domains in SCOPe 2.07: d2gs7a_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (255)
    Domains in SCOPe 2.07: d2gs7b_
  • Heterogens: MG, IOD, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gs7A (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gs7A (A:)
    llrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeilde
    ayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqia
    kgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhkvpikwmalesi
    lhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymi
    mrkcwmidadsrpkfreliiefskmardpqrylviqgdvvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gs7B (B:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gs7B (B:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhakvpikwmal
    esilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidv
    ymimrkcwmidadsrpkfreliiefskmardpqrylviqgdvvdadey