PDB entry 2gs6

View 2gs6 on RCSB PDB site
Description: Crystal Structure of the active EGFR kinase domain in complex with an ATP analog-peptide conjugate
Class: transferase
Keywords: EGFR, kinase,active, ATP-analog peptide conjugate, TRANSFERASE
Deposited on 2006-04-25, released 2006-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2C9 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d2gs6a2, d2gs6a3
  • Chain 'B':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2GS6
  • Heterogens: CL, 112, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gs6A (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gs6A (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikeltspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsedmd
    dvvdadeylip
    

  • Chain 'B':
    No sequence available.