PDB entry 2gs0

View 2gs0 on RCSB PDB site
Description: NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and the activation domain of p53
Class: transcription
Keywords: p53, TFIIH, Tfb1, activation, transcription, PH domain
Deposited on 2006-04-25, released 2006-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae
    Gene: TFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (0-114)
      • engineered (0)
    Domains in SCOP 1.75: d2gs0a1
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS
    Gene: TP53
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gs0A (A:)
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

  • Chain 'B':
    No sequence available.