PDB entry 2grx

View 2grx on RCSB PDB site
Description: Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for ferrichrome
Class: metal transport
Keywords: beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein
Deposited on 2006-04-25, released 2006-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-13, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.284
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrichrome-iron receptor
    Species: Escherichia coli
    Gene: fhuA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2grxa1
  • Chain 'B':
    Compound: Ferrichrome-iron receptor
    Species: Escherichia coli
    Gene: fhuA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2grxb1
  • Chain 'C':
    Compound: Protein tonB
    Species: Escherichia coli
    Gene: tonB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2grxc1
  • Chain 'D':
    Compound: Protein tonB
    Species: Escherichia coli
    Gene: tonB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2grxd1
  • Heterogens: PO4, FTT, DPO, DAO, MYR, EAP, FCI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2grxA (A:)
    avepkedtitvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemal
    hqpksvkealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndav
    idpymleraeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdf
    sdsldddgvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepe
    tgyygwlpkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnl
    rfaenktsqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtq
    lqskfatgdidhtlltgvdfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntd
    fdfnakdpansgpyrilnkqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttd
    krddkqftwrggvnylfdngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvp
    edrpivvtgavynltktnnlmadpegsffsveggeirargveieakaalsasvnvvgsyt
    ytdaeyttdttykgntpaqvpkhmaslwadytffdgplsgltlgtggrytgssygdpans
    fkvgsytvvdalvrydlarvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvat
    atfrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grxA (A:)
    titvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvk
    ealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymle
    raeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdslddd
    gvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwl
    pkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenkt
    sqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfat
    gdidhtlltgvdfmrmrndinawfgyddsvpllnltdfdfnakdpansgpyrilnkqkqt
    gvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtp
    yfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmad
    pegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqvpkh
    maslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgma
    gsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2grxB (B:)
    avepkedtitvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemal
    hqpksvkealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndav
    idpymleraeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdf
    sdsldddgvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepe
    tgyygwlpkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnl
    rfaenktsqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtq
    lqskfatgdidhtlltgvdfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntd
    fdfnakdpansgpyrilnkqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttd
    krddkqftwrggvnylfdngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvp
    edrpivvtgavynltktnnlmadpegsffsveggeirargveieakaalsasvnvvgsyt
    ytdaeyttdttykgntpaqvpkhmaslwadytffdgplsgltlgtggrytgssygdpans
    fkvgsytvvdalvrydlarvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvat
    atfrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grxB (B:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnltdfdfnakdpansgpyrilnkqkqtgvyvqdqaqwd
    kvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdngvtpyfsysesfeps
    sqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnlmadpegsffsvegg
    eirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqvpkhmaslwadytff
    dgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarvgmagsnvalhvnnl
    fdreyvascfntygcfwgaerqvvatatfrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2grxC (C:)
    gsshhhhhhssglvprgshmsvhqvielpapaqpisvtmvtpadleppqavqpppepvve
    pepepepipeppkeapvviekpkpkpkpkpkpvkkvqeqpkrdvkpvesrpaspfentap
    arltsstataatskpvtsvasgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdn
    vqilsakpanmferevknamrrwryepgkpgsgivvnilfkingtteiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grxC (C:)
    rnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryep
    gkpgsgivvnilfkingt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2grxD (D:)
    gsshhhhhhssglvprgshmsvhqvielpapaqpisvtmvtpadleppqavqpppepvve
    pepepepipeppkeapvviekpkpkpkpkpkpvkkvqeqpkrdvkpvesrpaspfentap
    arltsstataatskpvtsvasgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdn
    vqilsakpanmferevknamrrwryepgkpgsgivvnilfkingtteiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grxD (D:)
    rnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamrrwryep
    gkpgsgivvnilfkingt