PDB entry 2gro

View 2gro on RCSB PDB site
Description: Crystal Structure of human RanGAP1-Ubc9-N85Q
Class: ligase
Keywords: ubiquitin, conjugation, small ubiquitin like modifer, smt3, LIGASE
Deposited on 2006-04-24, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 I
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2I, UBC9, UBCE9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63279 (3-End)
      • engineered (87)
    Domains in SCOPe 2.06: d2groa_
  • Chain 'B':
    Compound: ran gtpase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RANGAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2grob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2groA (A:)
    gshmsgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpweggl
    fklrmlfkddypssppkckfepplfhpqvypsgtvclsileedkdwrpaitikqillgiq
    ellnepniqdpaqaeaytiycqnrveyekrvraqakkfaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2groA (A:)
    msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
    rmlfkddypssppkckfepplfhpqvypsgtvclsileedkdwrpaitikqillgiqell
    nepniqdpaqaeaytiycqnrveyekrvraqakkfap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2groB (B:)
    stgepapvlsspppadvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvs
    svfkdeatvrmavqdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlyg
    plmalnhmvqqdyfpkalaplllafvtkpnsalescsfarhsllqtlykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2groB (B:)
    padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
    qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
    fpkalaplllafvtkpnsalescsfarhsllqtlykv