PDB entry 2grl

View 2grl on RCSB PDB site
Description: Crystal structure of dCT/iCF10 complex
Class: transcription
Keywords: receptor, inhibitor, TRANSCRIPTION
Deposited on 2006-04-24, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAA65845 (0-End)
    Domains in SCOPe 2.07: d2grla1, d2grla2
  • Chain 'B':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAA65845 (0-End)
    Domains in SCOPe 2.07: d2grlb1, d2grlb2
  • Chain 'C':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAA65845 (0-End)
    Domains in SCOPe 2.07: d2grlc1, d2grlc2
  • Chain 'D':
    Compound: PrgX
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAA65845 (0-End)
    Domains in SCOPe 2.07: d2grld1, d2grld2
  • Chain 'E':
    Compound: peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2GRL (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2grlA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grlA (A:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2grlB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grlB (B:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2grlC (C:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grlC (C:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisake
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2grlD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyye
    nyvaiennpipeikeqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2grlD (D:)
    mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
    ilnragmntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisia
    hhynievptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivd
    sfgkdydltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylk
    qiyqfltdknidsylnavniinifkiigkedihrslveeltkisak
    

  • Chain 'E':
    No sequence available.