PDB entry 2gri

View 2gri on RCSB PDB site
Description: NMR Structure of the SARS-CoV non-structural protein nsp3a
Class: viral protein
Keywords: SARS-CoV, non-structural protein, nsp3, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, VIRAL PROTEIN
Deposited on 2006-04-24, released 2006-12-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nsp3
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gria1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2griA (A:)
apikgvtfgedtvwevqgyknvritfeldervdkvlnekcsvytvesgtevtefacvvae
avvktlqpvsdlltnmgidldewsvatfylfddageenfssrmycsfyppde