PDB entry 2grg

View 2grg on RCSB PDB site
Description: Solution NMR Structure of Protein YNR034W-A from Saccharomyces cerevisiae. Northeast Structural Genomics Consortium Target YT727; Ontario Center for Structural Proteomics Target yst6499.
Class: structural genomics, unknown function
Keywords: helix/beta strand protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-04-24, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein; Ynr034w-ap
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • GB NP_061494 (22-119)
  Domains in SCOPe 2.08: d2grga1, d2grga2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2grgA (A:)
  mgsshhhhhhssgrenlyfqghmkssipitevlpravgsltfdenynlldtsgvakviek
  spiaeiirksnaelgrlgysvyedaqyighafkkaghfivyftpknknregvvppvgitn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2grgA (A:)
  mkssipitevlpravgsltfdenynlldtsgvakviekspiaeiirksnaelgrlgysvy
  edaqyighafkkaghfivyftpknknregvvppvgitn