PDB entry 2grc

View 2grc on RCSB PDB site
Description: 1.5 A structure of bromodomain from human BRG1 protein, a central ATPase of SWI/SNF remodeling complex
Class: hydrolase
Keywords: Bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions, HYDROLASE
Deposited on 2006-04-24, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.243
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable global transcription activator SNF2L4
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA4, BRG1, SNF2B, SNF2L4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2grca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2grcA (A:)
maeklspnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvd
fkkikerirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkiek
eddsegees

    Sequence, based on observed residues (ATOM records): (download) 
    >2grcA (A:)
eklspnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfk
kikerirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkieked
d