PDB entry 2gra

View 2gra on RCSB PDB site
Description: crystal structure of Human Pyrroline-5-carboxylate Reductase complexed with nadp
Class: oxidoreductase
Keywords: Human Pyrroline-5-carboxylate Reductase, NADPH, OXIDOREDUCTASE
Deposited on 2006-04-23, released 2006-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.228
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2graa1, d2graa2
  • Chain 'B':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2grab1, d2grab2
  • Chain 'C':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2grac1, d2grac2
  • Chain 'D':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2grad1, d2grad2
  • Chain 'E':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2grae1, d2grae2
  • Heterogens: NAP, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2graA (A:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2graB (B:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2graB (B:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvltphnket
    vqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvir
    cmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpa
    yaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggati
    halhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2graC (C:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2graD (D:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2graE (E:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe