PDB entry 2gr9

View 2gr9 on RCSB PDB site
Description: Crystal structure of P5CR complexed with NADH
Class: oxidoreductase
Keywords: crystal strucutre, Human Pyrroline-5-carboxylate Reductase, nadh, OXIDOREDUCTASE
Deposited on 2006-04-23, released 2006-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.241
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2gr9a1, d2gr9a2
  • Chain 'B':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2gr9b1, d2gr9b2
  • Chain 'C':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2gr9c1, d2gr9c2
  • Chain 'D':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2gr9d1, d2gr9d2
  • Chain 'E':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-276)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2gr9e1, d2gr9e2
  • Heterogens: NAI, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gr9A (A:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gr9B (B:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr9B (B:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvltphnket
    vqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvir
    cmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpa
    yaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggati
    halhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gr9C (C:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gr9D (D:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gr9E (E:)
    rgmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe