PDB entry 2gr7

View 2gr7 on RCSB PDB site
Description: Hia 992-1098
Class: membrane protein
Keywords: Trimeric autotransporter, adhesion, membrane protein, protein secretion, microbial pathogenesis
Deposited on 2006-04-23, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adhesin
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gr7a1
  • Chain 'B':
    Compound: adhesin
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gr7b_
  • Chain 'C':
    Compound: adhesin
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gr7c_
  • Chain 'D':
    Compound: adhesin
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gr7d_
  • Chain 'E':
    Compound: adhesin
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gr7e_
  • Chain 'F':
    Compound: adhesin
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gr7f_
  • Heterogens: C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gr7A (A:)
    aswshpqfeksggggglvprgsngsqlyavakgvtnlagqvnnlegkvnkvgkradagta
    salaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgttnsqgktg
    vaagvgyqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr7A (A:)
    avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
    qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gr7B (B:)
    aswshpqfeksggggglvprgsngsqlyavakgvtnlagqvnnlegkvnkvgkradagta
    salaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgttnsqgktg
    vaagvgyqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr7B (B:)
    avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
    qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gr7C (C:)
    aswshpqfeksggggglvprgsngsqlyavakgvtnlagqvnnlegkvnkvgkradagta
    salaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgttnsqgktg
    vaagvgyqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr7C (C:)
    avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
    qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gr7D (D:)
    aswshpqfeksggggglvprgsngsqlyavakgvtnlagqvnnlegkvnkvgkradagta
    salaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgttnsqgktg
    vaagvgyqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr7D (D:)
    avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
    qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gr7E (E:)
    aswshpqfeksggggglvprgsngsqlyavakgvtnlagqvnnlegkvnkvgkradagta
    salaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgttnsqgktg
    vaagvgyqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr7E (E:)
    avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
    qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gr7F (F:)
    aswshpqfeksggggglvprgsngsqlyavakgvtnlagqvnnlegkvnkvgkradagta
    salaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgttnsqgktg
    vaagvgyqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gr7F (F:)
    avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
    qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw