PDB entry 2gqv

View 2gqv on RCSB PDB site
Description: High-resolution structure of a plasmid-encoded dihydrofolate reductase: pentagonal network of water molecules in the D2-symmetric active site
Class: oxidoreductase
Keywords: anisotropic refinement, atomic-resolution structure, folate metabolism, plasmid-encoded R67 DHFR, TMP-resistant DHFR, OXIDOREDUCTASE
Deposited on 2006-04-22, released 2007-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.105
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrofolate reductase type 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gqva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2gqvA (A:)
vfpsnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
in

    Sequence, based on observed residues (ATOM records): (download) 
    >2gqvA (A:)
snatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin