PDB entry 2gqn

View 2gqn on RCSB PDB site
Description: Cystathionine Beta-Lyase (CBL) from Escherichia Coli in complex with N-Hydrazinocarbonylmethyl-2-Nitro-Benzamide
Class: lyase
Keywords: protein-inhibitor complex, PLP cofactor covalently bount to BLP Inhibitor, LYASE
Deposited on 2006-04-21, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine beta-lyase
    Species: Escherichia coli [TaxId:562]
    Gene: METC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gqna_
  • Chain 'B':
    Compound: Cystathionine beta-lyase
    Species: Escherichia coli [TaxId:562]
    Gene: METC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gqnb_
  • Heterogens: BLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gqnA (A:)
    mgsshhhhhhssglvprgshmadkkldtqlvnagrskkytlgavnsviqrasslvfdsve
    akkhatrnrangelfygrrgtlthfslqqamceleggagcvlfpcgaaavansilafieq
    gdhvlmtntayepsqdfcskilsklgvttswfdpligadivkhlqpntkivflespgsit
    mevhdvpaivaavrsvvpdaiimidntwaagvlfkaldfgidvsiqaatkylvghsdami
    gtavcnarcweqlrenaylmgqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaeh
    pqvarvnhpalpgskghefwkrdftgssglfsfvlkkklnneelanyldnfslfsmaysw
    ggyeslilanqpehiaairpqgeidfsgtlirlhigledvddliadldagfariv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gqnA (A:)
    kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
    fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskilsk
    lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
    dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
    dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
    tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
    dfsgtlirlhigledvddliadldagfariv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gqnB (B:)
    mgsshhhhhhssglvprgshmadkkldtqlvnagrskkytlgavnsviqrasslvfdsve
    akkhatrnrangelfygrrgtlthfslqqamceleggagcvlfpcgaaavansilafieq
    gdhvlmtntayepsqdfcskilsklgvttswfdpligadivkhlqpntkivflespgsit
    mevhdvpaivaavrsvvpdaiimidntwaagvlfkaldfgidvsiqaatkylvghsdami
    gtavcnarcweqlrenaylmgqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaeh
    pqvarvnhpalpgskghefwkrdftgssglfsfvlkkklnneelanyldnfslfsmaysw
    ggyeslilanqpehiaairpqgeidfsgtlirlhigledvddliadldagfariv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gqnB (B:)
    kkldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlt
    hfslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskils
    klgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiim
    idntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqm
    vdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrd
    ftgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqge
    idfsgtlirlhigledvddliadldagfariv