PDB entry 2gqh

View 2gqh on RCSB PDB site
Description: Solution structure of the 15th Ig-like domain of human KIAA1556 protein
Class: contractile protein
Keywords: beta-sandwich, ig-fold, Obscurin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2006-04-21, released 2006-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1556 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA1556
  Database cross-references and differences (RAF-indexed):
  • GB BAB13382 (7-100)
    • cloning artifact (0-6)
    • cloning artifact (101-106)
  Domains in SCOPe 2.06: d2gqha1, d2gqha2, d2gqha3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gqhA (A:)
  gssgssgarfteglrneeamegatatlqcelskaapvewrkglealrdgdkyslrqdgav
  celqihglamadngvyscvcgqertsatltvralparfiedsgpssg