PDB entry 2gqg

View 2gqg on RCSB PDB site
Description: X-ray Crystal Structure of Dasatinib (BMS-354825) Bound to Activated ABL Kinase Domain
Class: transferase
Keywords: Kinase, TRANSFERASE
Deposited on 2006-04-20, released 2006-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (6-277)
      • cloning artifact (0-5)
      • modified residue (170)
    Domains in SCOPe 2.04: d2gqga_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (6-End)
      • cloning artifact (0-5)
      • modified residue (170)
    Domains in SCOPe 2.04: d2gqgb_
  • Heterogens: 1N1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gqgA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gqgB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gqgB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqe