PDB entry 2gqe

View 2gqe on RCSB PDB site
Description: Molecular characterization of the Ran binding zinc finger domain
Class: transport protein
Keywords: Zinc finger, Ran, Nuclear Pore, zinc knuckle, nucleoporin, pore, transport, NUP153, NUP358, RanBP2, TRANSPORT PROTEIN
Deposited on 2006-04-20, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nuclear pore complex protein Nup153
  Species: Homo sapiens [TaxId:9606]
  Gene: NUP153
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49790 (3-31)
    • cloning artifact (0-2)
  Domains in SCOPe 2.08: d2gqea1, d2gqea2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gqeA (A:)
  ghmvigtwdcdtclvqnkpeaikcvacetpkp