PDB entry 2gqd

View 2gqd on RCSB PDB site
Description: The crystal structure of B-ketoacyl-ACP synthase II (FabF) from Staphylococcus aureus
Class: transferase
Keywords: duplicated BABABABB fold, TRANSFERASE
Deposited on 2006-04-20, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: fabF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gqda1, d2gqda2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: fabF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gqdb1, d2gqdb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gqdA (A:)
    mgsshhhhhhssglvprgshmlemsqnkrvvitgmgalspigndvkttwenalkgvngid
    kitridtepysvhlagelknfniedhidkkearrmdrftqyaivaareavkdaqldinen
    tadrigvwigsgiggmetfeiahkqlmdkgprrvspffvpmlipdmatgqvsidlgakgp
    ngatvtacatgtnsigeafkivqrgdadamitggteapithmaiagfsasralstnddie
    tacrpfqegrdgfvmgegagilvieslesaqarganiyaeivgygttgdayhitapapeg
    eggsramqaamddagiepkdvqylnahgtstpvgdlnevkaikntfgeaakhlkvsstks
    mtghllgatggieaifsalsikdskvaptihavtpdpecdldivpneaqdldityamsns
    lgfgghnavlvfkkfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gqdA (A:)
    nkrvvitgmgalspigndvkttwenalkgvngidkitridtepysvhlagelknfniedh
    idkkearrmdrftqyaivaareavkdaqldinentadrigvwigsgiggmetfeiahkql
    mdkgprrvspffvpmlipdmatgqvsidlgakgpngatvtacatgtnsigeafkivqrgd
    adamitggteapithmaiagfsasralstnddietacrpfqegrdgfvmgegagilvies
    lesaqarganiyaeivgygttgdayhitapapegeggsramqaamddagiepkdvqylna
    hgtstpvgdlnevkaikntfgeaakhlkvsstksmtghllgatggieaifsalsikdskv
    aptihavtpdpecdldivpneaqdldityamsnslgfgghnavlvfkkfea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gqdB (B:)
    mgsshhhhhhssglvprgshmlemsqnkrvvitgmgalspigndvkttwenalkgvngid
    kitridtepysvhlagelknfniedhidkkearrmdrftqyaivaareavkdaqldinen
    tadrigvwigsgiggmetfeiahkqlmdkgprrvspffvpmlipdmatgqvsidlgakgp
    ngatvtacatgtnsigeafkivqrgdadamitggteapithmaiagfsasralstnddie
    tacrpfqegrdgfvmgegagilvieslesaqarganiyaeivgygttgdayhitapapeg
    eggsramqaamddagiepkdvqylnahgtstpvgdlnevkaikntfgeaakhlkvsstks
    mtghllgatggieaifsalsikdskvaptihavtpdpecdldivpneaqdldityamsns
    lgfgghnavlvfkkfea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gqdB (B:)
    nkrvvitgmgalspigndvkttwenalkgvngidkitridtepysvhlagelknfniedh
    idkkearrmdrftqyaivaareavkdaqldinentadrigvwigsgiggmetfeiahkql
    mdkgprrvspffvpmlipdmatgqvsidlgakgpngatvtacatgtnsigeafkivqrgd
    adamitggteapithmaiagfsasralstnddietacrpfqegrdgfvmgegagilvies
    lesaqarganiyaeivgygttgdayhitapapegeggsramqaamddagiepkdvqylna
    hgtstpvgdlnevkaikntfgeaakhlkvsstksmtghllgatggieaifsalsikdskv
    aptihavtpdpecdldivpneaqdldityamsnslgfgghnavlvfkkfea