PDB entry 2gq3

View 2gq3 on RCSB PDB site
Description: mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme A
Class: transferase
Keywords: TIM barrel, coenzyme A, TRANSFERASE
Deposited on 2006-04-19, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glcB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gq3a_
  • Chain 'B':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glcB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gq3b_
  • Heterogens: MG, MLT, COA, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gq3A (A:)
    gsmtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnard
    elqaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlv
    vpvlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkfldd
    svplssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglh
    ieilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgd
    laaavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsev
    fegimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrved
    vlglpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmv
    rkgtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragas
    tawvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireev
    dnncqsilgyvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadv
    raslermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrr
    refkaraae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gq3A (A:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrrpidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlna
    rfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplss
    gsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilid
    pesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaavd
    kdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimd
    alftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpq
    ntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmk
    sqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvps
    ptaatlhalhyhqvdvaavqqglagkrratieqlltiplakwapdeireevdnncqsilg
    yvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermap
    lvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gq3B (B:)
    gsmtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnard
    elqaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlv
    vpvlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkfldd
    svplssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglh
    ieilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgd
    laaavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsev
    fegimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrved
    vlglpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmv
    rkgtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragas
    tawvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireev
    dnncqsilgyvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadv
    raslermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrr
    refkaraae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gq3B (B:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
    lnarfalnaanarwgslydalygtdvipeaekgptynkvrgdkviayarkflddsvplss
    gsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilid
    pesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaalr
    vlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftglia
    ihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigim
    deerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilay
    edhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha
    lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrw
    vdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrq
    nagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraa