PDB entry 2gpv

View 2gpv on RCSB PDB site
Description: Estrogen Related Receptor-gamma ligand binding domain complexed with 4-hydroxy-tamoxifen and a SMRT peptide
Class: transcription
Keywords: Estrogen related receptor, ERR, ERRg, ESRRG, Nuclear Receptor, Steroid Receptor, SMRT, Tamoxifen, TRANSCRIPTION
Deposited on 2006-04-18, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gpva_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gpvb_
  • Chain 'C':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gpvc_
  • Chain 'D':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gpvd_
  • Chain 'E':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gpve_
  • Chain 'F':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gpvf_
  • Chain 'G':
    Compound: Nuclear receptor corepressor 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Nuclear receptor corepressor 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Nuclear receptor corepressor 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gpvA (A:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpvA (A:)
    kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
    lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
    lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
    rragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gpvB (B:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpvB (B:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gpvC (C:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpvC (C:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gpvD (D:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpvD (D:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfynikle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gpvE (E:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpvE (E:)
    ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
    ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
    kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
    agkmlmtlpllrqtstkavqhfynikle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gpvF (F:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpvF (F:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfynikl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.