PDB entry 2gps

View 2gps on RCSB PDB site
Description: Crystal Structure of the Biotin Carboxylase Subunit, E23R mutant, of Acetyl-CoA Carboxylase from Escherichia coli.
Class: ligase
Keywords: ATP-grasp, carboxylase, biotin-dependent, fatty acid synthesis, dimer-interface mutant, LIGASE
Deposited on 2006-04-18, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: accC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24182 (20-End)
      • cloning artifact (15-19)
      • engineered (42)
    Domains in SCOPe 2.08: d2gpsa1, d2gpsa2, d2gpsa3, d2gpsa4
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: accC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24182 (20-End)
      • cloning artifact (15-19)
      • engineered (42)
    Domains in SCOPe 2.08: d2gpsb1, d2gpsb2, d2gpsb3, d2gpsb4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gpsA (A:)
    mgsshhhhhhssglvprgshmldkivianrgeialrilrackrlgiktvavhssadrdlk
    hvlladetvcigpapsvksylnipaiisaaeitgavaihpgygflsenanfaeqversgf
    ifigpkaetirlmgdkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviika
    sgggggrgmrvvrgdaelaqsismtraeakaafsndmvymekylenprhveiqvladgqg
    naiylaerdcsmqrrhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfe
    ngefyfiemntriqvehpvtemitgvdlikeqlriaagqplsikqeevhvrghavecrin
    aedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklicygenrdvaia
    rmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpsA (A:)
    prgshmldkivianrgeialrilrackrlgiktvavhssadrdlkhvlladetvcigpap
    svksylnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgd
    kvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggmrvvrgdaela
    qsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkv
    veeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpv
    temitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfha
    pggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvd
    lqirimndenfqhggtnihylekklgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gpsB (B:)
    mgsshhhhhhssglvprgshmldkivianrgeialrilrackrlgiktvavhssadrdlk
    hvlladetvcigpapsvksylnipaiisaaeitgavaihpgygflsenanfaeqversgf
    ifigpkaetirlmgdkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviika
    sgggggrgmrvvrgdaelaqsismtraeakaafsndmvymekylenprhveiqvladgqg
    naiylaerdcsmqrrhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfe
    ngefyfiemntriqvehpvtemitgvdlikeqlriaagqplsikqeevhvrghavecrin
    aedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklicygenrdvaia
    rmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpsB (B:)
    prgshmldkivianrgeialrilrackrlgiktvavhssadrdlkhvlladetvcigpap
    svksylnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgd
    kvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasggmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklgl