PDB entry 2gpp

View 2gpp on RCSB PDB site
Description: Estrogen Related Receptor-gamma ligand binding domain complexed with a RIP140 peptide and synthetic ligand GSK4716
Class: transcription
Keywords: Estrogen related receptor, ERR, ERRg, ESRRG, Nuclear Receptor, Steroid Receptor, RIP140, TRANSCRIPTION
Deposited on 2006-04-18, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gppa_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gppb_
  • Chain 'C':
    Compound: Nuclear receptor-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nuclear receptor-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gppA (A:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gppA (A:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gppB (B:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gppB (B:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.