PDB entry 2gpo

View 2gpo on RCSB PDB site
Description: Estrogen Related Receptor-gamma ligand binding domain complexed with a synthetic peptide from RIP140
Class: transcription
Keywords: Estrogen related receptor, ERR, ERRg, ESRRG, Nuclear Receptor, Steroid Receptor, RIP140, TRANSCRIPTION
Deposited on 2006-04-18, released 2006-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gpoa_
  • Chain 'C':
    Compound: Nuclear receptor-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gpoA (A:)
    pakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipg
    fstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnna
    ilqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhm
    edprragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gpoA (A:)
    nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
    adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
    kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
    gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
    

  • Chain 'C':
    No sequence available.